General Information

  • ID:  hor003292
  • Uniprot ID:  P50175
  • Protein name:  Synenkephalin
  • Gene name:  PENK
  • Organism:  Mesocricetus auratus (Golden hamster)
  • Family:  Opioid neuropeptide precursor family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mesocricetus (genus), Cricetinae (subfamily), Cricetidae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001515 opioid peptide activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region; GO:0031410 cytoplasmic vesicle; GO:0034466 chromaffin granule lumen

Sequence Information

  • Sequence:  ECSQDCAKCSYHLVSPGDINFLACTLECEGQMPSHKIWETCKDLLQVSKPEFPCDSINMFKDSNKQDESHLLA
  • Length:  73(25-97)
  • Propeptide:  MARFLRLCTWLLVLGSCLLATVQAECSQDCAKCSYHLVSPGDINFLACTLECEGQMPSHKIWETCKDLLQVSKPEFPCDSINMFKDSNKQDESHLLAKKYGGFMKRYGGFMKKMDELYPVEPEEEANGGEILAKKYGGFMKKDADEGDTLANSSDLLKELLGTGDNRAREGRHQESTDNDDNMSKRYGGFMRGLKRSPQVEDEAKELQKRYGGFMRRVGRPEWWMDYQKRYGGFLKRFAESLPSDEEAESYSKEV
  • Signal peptide:  MARFLRLCTWLLVLGSCLLATVQA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Met-enkephalin]: Neuropeptide that competes with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Oprm1, Oprd1
  • Target Unid:   A0A1U7Q3K1, A0A1U7QRW6
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  2-24; 6-28; 9-41
  • Structure ID:  AF-P50175-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003292_AF2.pdbhor003292_ESM.pdb

Physical Information

Mass: 952279 Formula: C353H547N93O116S9
Absent amino acids: R Common amino acids: SCL
pI: 4.5 Basic residues: 9
Polar residues: 23 Hydrophobic residues: 19
Hydrophobicity: -45.34 Boman Index: -12550
Half-Life / Aliphatic Index: 1 hour Aliphatic Index: 65.48
Instability Index: 7805.89 Extinction Coefficient cystines: 7365
Absorbance 280nm: 102.29

Literature

  • PubMed ID:  NA
  • Title:  NA